Lineage for d1d6ja_ (1d6j A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109870Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 protein domains)
    automatically mapped to Pfam PF01583
  6. 2109871Protein Adenosine-5'phosphosulfate kinase (APS kinase) [52573] (2 species)
  7. 2109872Species Fungus (Penicillium chrysogenum) [TaxId:5076] [52574] (3 PDB entries)
  8. 2109881Domain d1d6ja_: 1d6j A: [31940]
    complexed with tla

Details for d1d6ja_

PDB Entry: 1d6j (more details), 2 Å

PDB Description: crystal structure of adenosine 5'-phosphosulfate (aps) kinase from penicillium chrysogenum
PDB Compounds: (A:) adenosine-5'phosphosulfate kinase

SCOPe Domain Sequences for d1d6ja_:

Sequence, based on SEQRES records: (download)

>d1d6ja_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
hasaltrsertelrnqrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirf
glnkdlgfseadrnenirriaevaklfadsnsiaitsfispyrkdrdtarqlhevatpge
etglpfvevyvdvpvevaeqrdpkglykkaregvikeftgisapyeapanpevhvknyel
pvqdavkqiidyldtkgylpakk

Sequence, based on observed residues (ATOM records): (download)

>d1d6ja_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}
hasaltrsertelrnqrgltiwltglsasgkstlavelehqlvrdrrvhayrldgdnirf
glnkdlgfseadrnenirriaevaklfadsnsiaitsfispyrkdrdtarqlhevatpge
etglpfvevyvdvpveapyeapanpevhvknyelpvqdavkqiidyldtkgylpakk

SCOPe Domain Coordinates for d1d6ja_:

Click to download the PDB-style file with coordinates for d1d6ja_.
(The format of our PDB-style files is described here.)

Timeline for d1d6ja_: