SCOPe 2.08: Domain d1qhya_: 1qhy A:

Lineage for d1qhya_ (1qhy A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.3: Chloramphenicol phosphotransferase [52569] (1 protein)
   similar to the nucleotide/nucleoside kinases but acts on different substrate
   automatically mapped to Pfam PF07931

6. Protein Chloramphenicol phosphotransferase [52570] (1 species)

7. Species Streptomyces venezuelae [TaxId:54571] [52571] (6 PDB entries)

8. Domain d1qhya_: 1qhy A: [31939]
   complexed with ags, clm, mg, so4

Details for d1qhya_

PDB Entry: 1qhy, 2.6 Å

PDB Description: chloramphenicol phosphotransferase from streptomyces venezuelae in complex with atpgammas and chloramphenicol

PDB Compounds: (A:) chloramphenicol phosphotransferase

SCOPe Domain Sequences for d1qhya_:

Sequence; same for both SEQRES and ATOM records:

>d1qhya_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}
mttrmiilnggssagksgivrclqsvlpepwlafgvdslieamplkmqsaeggiefdadg
gvsigpefralegawaegvvamaragariiiddvflggaaaqerwrsfvgdldvlwvgvr
cdgavaegretargdrvagmaakqayvvhegveydvevdtthkesiecawaiaahvvp

Timeline for d1qhya_:

• d1qhya_ first appeared (with stable ids) in SCOP 1.55
  
• d1qhya_ appears in SCOPe 2.07