SCOPe 2.07: Domain d2n7ba1: 2n7b A:1-139

Lineage for d2n7ba1 (2n7b A:1-139)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d2n7ba1: 2n7b A:1-139 [319389]
   Other proteins in same PDB: d2n7ba2
   automated match to d1o7va_
   complexed with 0d8

Details for d2n7ba1

PDB Entry: 2n7b

PDB Description: solution structure of the human siglec-8 lectin domain in complex with 6'sulfo sialyl lewisx

PDB Compounds: (A:) Sialic acid-binding Ig-like lectin 8

SCOPe Domain Sequences for d2n7ba1:

Sequence; same for both SEQRES and ATOM records:

>d2n7ba1 b.1.1.1 (A:1-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
megdrqygdgyllqvqelvtvqeglsvhvpcsfsypqdgwtdsdpvhgywfragdrpyqd
apvatnnpdrevqaetqgrfqllgdiwsndcslsirdarkrdkgsyffrlergsmkwsyk
sqlnyktkqlsvfvtalth

Timeline for d2n7ba1:

• d2n7ba1 first appeared in SCOPe 2.06
  
• d2n7ba1 appears in the current release, SCOPe 2.08