SCOPe 2.06: Domain d5itqa1: 5itq A:2-131

Lineage for d5itqa1 (5itq A:2-131)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family)
   automatically mapped to Pfam PF01149

5. Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)

6. Protein automated matches [254692] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [267976] (2 PDB entries)

8. Domain d5itqa1: 5itq A:2-131 [319377]
   Other proteins in same PDB: d5itqa2, d5itqa3
   automated match to d1tdha2
   protein/DNA complex

Details for d5itqa1

PDB Entry: 5itq, 1.48 Å

PDB Description: crystal structure of human neil1, free protein

PDB Compounds: (A:) Endonuclease 8-like 1

SCOPe Domain Sequences for d5itqa1:

Sequence; same for both SEQRES and ATOM records:

>d5itqa1 b.113.1.1 (A:2-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlils
plpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrfg
rwdlggkwqp

Timeline for d5itqa1:

• d5itqa1 is new in SCOPe 2.06-stable
  
• d5itqa1 appears in SCOPe 2.07
  
• d5itqa1 appears in the current release, SCOPe 2.08