Lineage for d5itqa1 (5itq A:2-131)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409585Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2409586Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
    automatically mapped to Pfam PF01149
  5. 2409587Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 protein domains)
  6. 2409644Protein automated matches [254692] (3 species)
    not a true protein
  7. 2409647Species Human (Homo sapiens) [TaxId:9606] [267976] (2 PDB entries)
  8. 2409648Domain d5itqa1: 5itq A:2-131 [319377]
    Other proteins in same PDB: d5itqa2, d5itqa3
    automated match to d1tdha2
    protein/DNA complex

Details for d5itqa1

PDB Entry: 5itq (more details), 1.48 Å

PDB Description: crystal structure of human neil1, free protein
PDB Compounds: (A:) Endonuclease 8-like 1

SCOPe Domain Sequences for d5itqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5itqa1 b.113.1.1 (A:2-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlils
plpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrfg
rwdlggkwqp

SCOPe Domain Coordinates for d5itqa1:

Click to download the PDB-style file with coordinates for d5itqa1.
(The format of our PDB-style files is described here.)

Timeline for d5itqa1: