![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
![]() | Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) ![]() automatically mapped to Pfam PF01149 |
![]() | Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins) |
![]() | Protein automated matches [254692] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [267976] (2 PDB entries) |
![]() | Domain d5itqa1: 5itq A:2-131 [319377] Other proteins in same PDB: d5itqa2, d5itqa3 automated match to d1tdha2 protein/DNA complex |
PDB Entry: 5itq (more details), 1.48 Å
SCOPe Domain Sequences for d5itqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5itqa1 b.113.1.1 (A:2-131) automated matches {Human (Homo sapiens) [TaxId: 9606]} pegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlils plpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrfg rwdlggkwqp
Timeline for d5itqa1: