SCOPe 2.06: Domain d5i12a_: 5i12 A:

Lineage for d5i12a_ (5i12 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Gelatinase B (MMP-9) [75496] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75497] (16 PDB entries)

8. Domain d5i12a_: 5i12 A: [319372]
   automated match to d4xcta_
   complexed with ca, dms, edo, gol, h27, zn

Details for d5i12a_

PDB Entry: 5i12, 1.59 Å

PDB Description: crystal structure of the catalytic domain of mmp-9 in complex with a selective sugar-conjugated arylsulfonamide carboxylate water-soluble inhibitor (dc27).

PDB Compounds: (A:) Matrix metalloproteinase-9,Matrix metalloproteinase-9

SCOPe Domain Sequences for d5i12a_:

Sequence; same for both SEQRES and ATOM records:

>d5i12a_ d.92.1.11 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
dlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgv
aehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaahefghal
gldhssvpealmypmyrftegpplhkddvngirhlyg

Timeline for d5i12a_:

• d5i12a_ is new in SCOPe 2.06-stable
  
• d5i12a_ appears in SCOPe 2.07
  
• d5i12a_ appears in the current release, SCOPe 2.08