![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
![]() | Protein Gelatinase B (MMP-9) [75496] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries) |
![]() | Domain d5i12a_: 5i12 A: [319372] automated match to d4xcta_ complexed with ca, dms, edo, gol, h27, zn |
PDB Entry: 5i12 (more details), 1.59 Å
SCOPe Domain Sequences for d5i12a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i12a_ d.92.1.11 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} dlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgv aehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaahefghal gldhssvpealmypmyrftegpplhkddvngirhlyg
Timeline for d5i12a_: