Lineage for d5i12a_ (5i12 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964375Protein Gelatinase B (MMP-9) [75496] (1 species)
  7. 2964376Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries)
  8. 2964379Domain d5i12a_: 5i12 A: [319372]
    automated match to d4xcta_
    complexed with ca, dms, edo, gol, h27, zn

Details for d5i12a_

PDB Entry: 5i12 (more details), 1.59 Å

PDB Description: crystal structure of the catalytic domain of mmp-9 in complex with a selective sugar-conjugated arylsulfonamide carboxylate water-soluble inhibitor (dc27).
PDB Compounds: (A:) Matrix metalloproteinase-9,Matrix metalloproteinase-9

SCOPe Domain Sequences for d5i12a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i12a_ d.92.1.11 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
dlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgv
aehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaahefghal
gldhssvpealmypmyrftegpplhkddvngirhlyg

SCOPe Domain Coordinates for d5i12a_:

Click to download the PDB-style file with coordinates for d5i12a_.
(The format of our PDB-style files is described here.)

Timeline for d5i12a_: