Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) |
Family c.37.1.3: Chloramphenicol phosphotransferase [52569] (1 protein) |
Protein Chloramphenicol phosphotransferase [52570] (1 species) |
Species Streptomyces venezuelae [TaxId:54571] [52571] (6 PDB entries) |
Domain d1qhna_: 1qhn A: [31937] |
PDB Entry: 1qhn (more details), 2.7 Å
SCOP Domain Sequences for d1qhna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhna_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae} mttrmiilnggssagksgivrclqsvlpepwlafgvdslieamplkmqsaeggiefdadg gvsigpefralegawaegvvamaragariiiddvflggaaaqerwrsfvgdldvlwvgvr cdgavaegretargdrvagmaakqayvvhegveydvevdtthkesiecawaiaahvvp
Timeline for d1qhna_: