Lineage for d5ke4a1 (5ke4 A:1-207)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408524Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2408525Protein automated matches [193506] (4 species)
    not a true protein
  7. 2408526Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (52 PDB entries)
  8. 2408852Domain d5ke4a1: 5ke4 A:1-207 [319365]
    Other proteins in same PDB: d5ke4a2, d5ke4b2, d5ke4c2, d5ke4d2, d5ke4e2
    automated match to d2w8gc_
    complexed with 6s7

Details for d5ke4a1

PDB Entry: 5ke4 (more details), 2.55 Å

PDB Description: crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 6 nicotinic acetylcholine receptor in complex with 2-((5-(3,7- diazabicyclo[3.3.1]nonan-3-yl)pyridin-3-yl)oxy)- n,n- dimethylethanamine (bpc)
PDB Compounds: (A:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5ke4a1:

Sequence, based on SEQRES records: (download)

>d5ke4a1 b.96.1.0 (A:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtkhdikyncceeiytdvnlvvkfrer

Sequence, based on observed residues (ATOM records): (download)

>d5ke4a1 b.96.1.0 (A:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklns
lmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrls
fmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtkh
dikyncceeiytdvnlvvkfrer

SCOPe Domain Coordinates for d5ke4a1:

Click to download the PDB-style file with coordinates for d5ke4a1.
(The format of our PDB-style files is described here.)

Timeline for d5ke4a1: