Lineage for d5kind_ (5kin D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907817Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2907818Protein automated matches [190215] (38 species)
    not a true protein
  7. 2908061Species Streptococcus pneumoniae [TaxId:170187] [319363] (1 PDB entry)
  8. 2908063Domain d5kind_: 5kin D: [319364]
    Other proteins in same PDB: d5kina_, d5kinc_
    automated match to d4hpjb_
    complexed with gol

Details for d5kind_

PDB Entry: 5kin (more details), 2.45 Å

PDB Description: crystal structure of tryptophan synthase alpha beta complex from streptococcus pneumoniae
PDB Compounds: (D:) tryptophan synthase beta chain

SCOPe Domain Sequences for d5kind_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kind_ c.79.1.0 (D:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
qepnkdgfygkfggrfvpetlmtavlelekayresqadpsfqeelnqllrqyvgretply
yaknltqhiggakiylkredlnhtgahkinnalgqvwlakrmgkkkiiaetgagqhgvat
ataaalfnmectiymgeedvkrqalnvfrmellgakveavtdgsrvlkdavnaalrswva
niddthyilgsalgphpfpeivrdfqsvigreakqqyrdltgrdlpdalvacvgggsnai
glfhpfvedesvamygteaaglgvdtehhaatltkgrpgvlhgslmdvlqdahgqileaf
sisagldypgigpehshyhdikrasyvpvtdeealegfqllsrvegiipalesshaiafa
vklakelgpeksmivclsgrgdkdvvqvkdrleadaakk

SCOPe Domain Coordinates for d5kind_:

Click to download the PDB-style file with coordinates for d5kind_.
(The format of our PDB-style files is described here.)

Timeline for d5kind_: