Lineage for d5kinc_ (5kin C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413784Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2414536Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2414537Protein automated matches [190292] (35 species)
    not a true protein
  7. 2414744Species Streptococcus pneumoniae [TaxId:170187] [319360] (1 PDB entry)
  8. 2414746Domain d5kinc_: 5kin C: [319361]
    Other proteins in same PDB: d5kinb_, d5kind_
    automated match to d1tjra1
    complexed with gol

Details for d5kinc_

PDB Entry: 5kin (more details), 2.45 Å

PDB Description: crystal structure of tryptophan synthase alpha beta complex from streptococcus pneumoniae
PDB Compounds: (C:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d5kinc_:

Sequence, based on SEQRES records: (download)

>d5kinc_ c.1.2.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
mpktlteklnaikaagkgifvpyimagdhekgldglaetihfledlgvsaievgipfsdp
vadgpvieeaglrslahgtstqalvetlktieteiplvimtyfnplfqygvenfvkdlad
tavkgliipdlphehanfvepflantdialiplvslttgierqkeliegaegfiyavain
gvtgksgnyradldkhlaqlhqvadipvltgfgvssqadlerfnavsdgvivgskivkal
hqgepiqdfirqavayqk

Sequence, based on observed residues (ATOM records): (download)

>d5kinc_ c.1.2.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
mpktlteklnaikaagkgifvpyimagdhekgldglaetihfledlgvsaievgipfsdp
vadgpvieeaglrslahgtstqalvetlktieteiplvimtyfnplfqygvenfvkdlad
tavkgliipdlphehanfvepflantdialiplvslttgierqkeliegaegfiyavain
gnyradldkhlaqlhqvadipvltgfgvssqadlerfnavsdgvivgskivkalhqgepi
qdfirqavayqk

SCOPe Domain Coordinates for d5kinc_:

Click to download the PDB-style file with coordinates for d5kinc_.
(The format of our PDB-style files is described here.)

Timeline for d5kinc_: