Lineage for d5jrud_ (5jru D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009508Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
    an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity
  4. 3009509Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) (S)
  5. 3009510Family d.278.1.1: H-NOX domain [111127] (2 proteins)
    binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains
    automatically mapped to Pfam PF07700
  6. 3009511Protein Methyl-accepting chemotaxis protein [111128] (1 species)
  7. 3009512Species Thermoanaerobacter tengcongensis [TaxId:119072] [111129] (18 PDB entries)
    Uniprot Q8RBX6 1-191
  8. 3009550Domain d5jrud_: 5jru D: [319358]
    automated match to d1u55a_
    complexed with hem

Details for d5jrud_

PDB Entry: 5jru (more details), 2.31 Å

PDB Description: crystal structure of fe(ii) unliganded h-nox protein from c. subterraneus
PDB Compounds: (D:) methyl-accepting chemotaxis protein

SCOPe Domain Sequences for d5jrud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jrud_ d.278.1.1 (D:) Methyl-accepting chemotaxis protein {Thermoanaerobacter tengcongensis [TaxId: 119072]}
mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
pvfeykk

SCOPe Domain Coordinates for d5jrud_:

Click to download the PDB-style file with coordinates for d5jrud_.
(The format of our PDB-style files is described here.)

Timeline for d5jrud_: