SCOPe 2.08: Domain d5ehpa1: 5ehp A:3-110

Lineage for d5ehpa1 (5ehp A:3-110)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)

8. Domain d5ehpa1: 5ehp A:3-110 [319354]
   Other proteins in same PDB: d5ehpa3, d5ehpb3
   automated match to d2shpa2
   complexed with 5oa, po4

Details for d5ehpa1

PDB Entry: 5ehp, 1.85 Å

PDB Description: non-receptor protein tyrosine phosphatase shp2 in complex with allosteric inhibitor shp836

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d5ehpa1:

Sequence, based on SEQRES records:

>d5ehpa1 d.93.1.0 (A:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse

Sequence, based on observed residues (ATOM records):

>d5ehpa1 d.93.1.0 (A:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehqlkekngdvielkyplncadptse

Timeline for d5ehpa1:

• d5ehpa1 first appeared in SCOPe 2.06
  
• d5ehpa1 appears in SCOPe 2.07