Lineage for d5c5dc_ (5c5d C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857183Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2857299Family c.23.8.0: automated matches [191522] (1 protein)
    not a true family
  6. 2857300Protein automated matches [190879] (8 species)
    not a true protein
  7. 2857373Species Treponema denticola [TaxId:243275] [319248] (1 PDB entry)
  8. 2857376Domain d5c5dc_: 5c5d C: [319353]
    automated match to d3rg8g_
    complexed with edo

Details for d5c5dc_

PDB Entry: 5c5d (more details), 1.69 Å

PDB Description: crystal structure of treponema denticola pure2-s38d
PDB Compounds: (C:) phosphoribosylaminoimidazole carboxylase

SCOPe Domain Sequences for d5c5dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c5dc_ c.23.8.0 (C:) automated matches {Treponema denticola [TaxId: 243275]}
mrplviilmgsssdmghaekiaselktfgieyairigdahktaehvvsmlkeyealdrpk
lyitiagrsnalsgfvdgfvkgatiacpppsdsfagadiysslrmpsgispalvlepkna
allaarifslydkeiadsvksymesnaqkiieddsklk

SCOPe Domain Coordinates for d5c5dc_:

Click to download the PDB-style file with coordinates for d5c5dc_.
(The format of our PDB-style files is described here.)

Timeline for d5c5dc_: