SCOPe 2.05: Domain d2shkb_: 2shk B:

Lineage for d2shkb_ (2shk B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
   similar to the nucleotide/nucleoside kinases but acts on different substrate
   automatically mapped to Pfam PF01202

6. Protein Shikimate kinase (AroK) [52567] (4 species)

7. Species Erwinia chrysanthemi [TaxId:556] [52568] (3 PDB entries)

8. Domain d2shkb_: 2shk B: [31935]
   complexed with adp, mg

Details for d2shkb_

PDB Entry: 2shk, 2.6 Å

PDB Description: the three-dimensional structure of shikimate kinase from erwinia chrysanthemi complexed with adp

PDB Compounds: (B:) Shikimate kinase

SCOPe Domain Sequences for d2shkb_:

Sequence, based on SEQRES records:

>d2shkb_ c.37.1.2 (B:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}
mtepifmvgargcgkttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr
esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlqaspqahqr
ptltgrpiaeemeavlrerealyqdvahyvvdatqppaaivcelmqtmrlpa

Sequence, based on observed residues (ATOM records):

>d2shkb_ c.37.1.2 (B:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}
mtepifmvgargcgkttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr
esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlqltgrpiae
emeavlrerealyqdvahyvvdatqppaaivcelmqtmrlpa

Timeline for d2shkb_:

• d2shkb_ first appeared (with stable ids) in SCOP 1.55
  
• d2shkb_ appears in SCOPe 2.04
  
• d2shkb_ appears in SCOPe 2.06
  
• d2shkb_ appears in the current release, SCOPe 2.08