Lineage for d5g4rc_ (5g4r C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (11 species)
    not a true protein
  7. 2316984Species Human (Homo sapiens) [TaxId:9606] [187641] (716 PDB entries)
  8. 2317694Domain d5g4rc_: 5g4r C: [319348]
    automated match to d5fg5a_
    complexed with lf1

Details for d5g4rc_

PDB Entry: 5g4r (more details), 1.96 Å

PDB Description: bromodomain of human brpf1 with n-1,3-dimethyl-6-2r-2- methylpiperazin-1-yl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol- 5-yl-2-methoxybenzamide
PDB Compounds: (C:) Peregrin

SCOPe Domain Sequences for d5g4rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g4rc_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayr
ylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaek

SCOPe Domain Coordinates for d5g4rc_:

Click to download the PDB-style file with coordinates for d5g4rc_.
(The format of our PDB-style files is described here.)

Timeline for d5g4rc_: