SCOPe 2.08: Domain d5dcma1: 5dcm A:128-221

Lineage for d5dcma1 (5dcm A:128-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (25 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:1311] [319313] (1 PDB entry)

8. Domain d5dcma1: 5dcm A:128-221 [319339]
   Other proteins in same PDB: d5dcma2, d5dcmb2
   automated match to d3q9vb_

Details for d5dcma1

PDB Entry: 5dcm, 1.6 Å

PDB Description: structure of a lantibiotic response regulator: c-terminal domain of the nisin resistance regulator nsrr

PDB Compounds: (A:) PhoB family transcriptional regulator

SCOPe Domain Sequences for d5dcma1:

Sequence; same for both SEQRES and ATOM records:

>d5dcma1 a.4.6.0 (A:128-221) automated matches {Streptococcus agalactiae [TaxId: 1311]}
eltfggftltregllssqdkevilsptenkilsillmhpkqvvskeslleklwendsfid
qntlnvnmtrlrkkivpigfdyihtvrgvgyllq

Timeline for d5dcma1:

• d5dcma1 first appeared in SCOPe 2.06
  
• d5dcma1 appears in SCOPe 2.07