Lineage for d1shkb_ (1shk B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23062Family c.37.1.2: Shikimate kinase [52566] (1 protein)
  6. 23063Protein Shikimate kinase [52567] (1 species)
  7. 23064Species Erwinia chrysanthemi [TaxId:556] [52568] (2 PDB entries)
  8. 23066Domain d1shkb_: 1shk B: [31933]

Details for d1shkb_

PDB Entry: 1shk (more details), 1.9 Å

PDB Description: the three-dimensional structure of shikimate kinase from erwinia chrysanthemi

SCOP Domain Sequences for d1shkb_:

Sequence, based on SEQRES records: (download)

>d1shkb_ c.37.1.2 (B:) Shikimate kinase {Erwinia chrysanthemi}
mtepifmvgargcgkttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr
esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlaaspqahqr
ptltgapiaeemeavlrerealyqdvahyvvdatqppaaivcelmqtmrlpa

Sequence, based on observed residues (ATOM records): (download)

>d1shkb_ c.37.1.2 (B:) Shikimate kinase {Erwinia chrysanthemi}
mtepifmvgargcgkttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr
esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlqrpiaeeme
avlrerealyqdvahyvvdatqppaaivcelmqtmrlpa

SCOP Domain Coordinates for d1shkb_:

Click to download the PDB-style file with coordinates for d1shkb_.
(The format of our PDB-style files is described here.)

Timeline for d1shkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1shka_