SCOPe 2.07: Domain d5a6da1: 5a6d A:2-122

Lineage for d5a6da1 (5a6d A:2-122)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Thermococcus gammatolerans [TaxId:593117] [319283] (1 PDB entry)

8. Domain d5a6da1: 5a6d A:2-122 [319322]
   automated match to d3lx1a1

Details for d5a6da1

PDB Entry: 5a6d, 2.8 Å

PDB Description: proliferating cell nuclear antigen, pcna, from thermococcus gammatolerans

PDB Compounds: (A:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d5a6da1:

Sequence; same for both SEQRES and ATOM records:

>d5a6da1 d.131.1.0 (A:2-122) automated matches {Thermococcus gammatolerans [TaxId: 593117]}
pfeivfdgakefadliatasnlideaafkiteegvsmramdpsrvvlidlnlpesifsky
eveepetiginmdhfkkilkrgkskdtlilrkgdenfleitfegtakrtfrlplidveel
e

Timeline for d5a6da1:

• d5a6da1 first appeared in SCOPe 2.06
  
• d5a6da1 appears in the current release, SCOPe 2.08