Lineage for d1shka_ (1shk A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123904Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
    automatically mapped to Pfam PF01202
  6. 2123905Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 2123909Species Erwinia chrysanthemi [TaxId:556] [52568] (3 PDB entries)
  8. 2123912Domain d1shka_: 1shk A: [31932]
    complexed with mg

Details for d1shka_

PDB Entry: 1shk (more details), 1.9 Å

PDB Description: the three-dimensional structure of shikimate kinase from erwinia chrysanthemi
PDB Compounds: (A:) Shikimate kinase

SCOPe Domain Sequences for d1shka_:

Sequence, based on SEQRES records: (download)

>d1shka_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}
mtepifmvgargcgkttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr
esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlqaspqahqr
ptltgrpiaeemeavlrerealyqdvahyvvdatqppaaivcelmqtmrlpaa

Sequence, based on observed residues (ATOM records): (download)

>d1shka_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}
mtepifmvgargcgkttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr
esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlqiaeemeav
lrerealyqdvahyvvdatqppaaivcelmqtmrlpaa

SCOPe Domain Coordinates for d1shka_:

Click to download the PDB-style file with coordinates for d1shka_.
(The format of our PDB-style files is described here.)

Timeline for d1shka_: