| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
| Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
| Protein automated matches [190858] (24 species) not a true protein |
| Species Streptococcus agalactiae [TaxId:1311] [319313] (1 PDB entry) |
| Domain d5dcmb1: 5dcm B:127-221 [319314] Other proteins in same PDB: d5dcma2, d5dcmb2 automated match to d2jpba_ |
PDB Entry: 5dcm (more details), 1.6 Å
SCOPe Domain Sequences for d5dcmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dcmb1 a.4.6.0 (B:127-221) automated matches {Streptococcus agalactiae [TaxId: 1311]}
qeltfggftltregllssqdkevilsptenkilsillmhpkqvvskeslleklwendsfi
dqntlnvnmtrlrkkivpigfdyihtvrgvgyllq
Timeline for d5dcmb1: