Lineage for d5dcmb1 (5dcm B:127-221)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308617Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2308708Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2308709Protein automated matches [190858] (24 species)
    not a true protein
  7. 2308786Species Streptococcus agalactiae [TaxId:1311] [319313] (1 PDB entry)
  8. 2308788Domain d5dcmb1: 5dcm B:127-221 [319314]
    Other proteins in same PDB: d5dcma2, d5dcmb2
    automated match to d2jpba_

Details for d5dcmb1

PDB Entry: 5dcm (more details), 1.6 Å

PDB Description: structure of a lantibiotic response regulator: c-terminal domain of the nisin resistance regulator nsrr
PDB Compounds: (B:) PhoB family transcriptional regulator

SCOPe Domain Sequences for d5dcmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dcmb1 a.4.6.0 (B:127-221) automated matches {Streptococcus agalactiae [TaxId: 1311]}
qeltfggftltregllssqdkevilsptenkilsillmhpkqvvskeslleklwendsfi
dqntlnvnmtrlrkkivpigfdyihtvrgvgyllq

SCOPe Domain Coordinates for d5dcmb1:

Click to download the PDB-style file with coordinates for d5dcmb1.
(The format of our PDB-style files is described here.)

Timeline for d5dcmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dcmb2