Lineage for d5i2zd_ (5i2z D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2571026Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2571027Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2571114Domain d5i2zd_: 5i2z D: [319309]
    automated match to d4i03a_
    complexed with ca, dms, edo, pgo, v24, zn

Details for d5i2zd_

PDB Entry: 5i2z (more details), 2.3 Å

PDB Description: crystal structure of the catalytic domain of mmp-12 in complex with a selective sugar-conjugated triazole-linked carboxylate chelating water-soluble inhibitor (dc24).
PDB Compounds: (D:) Macrophage metalloelastase

SCOPe Domain Sequences for d5i2zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i2zd_ d.92.1.11 (D:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
vwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfarga
hgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhqighslglg
hssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d5i2zd_:

Click to download the PDB-style file with coordinates for d5i2zd_.
(The format of our PDB-style files is described here.)

Timeline for d5i2zd_: