Lineage for d5i43d_ (5i43 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964411Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2964412Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2964479Domain d5i43d_: 5i43 D: [319306]
    automated match to d4i03a_
    complexed with 67m, ca, dms, edo, pgo, zn

Details for d5i43d_

PDB Entry: 5i43 (more details), 1.95 Å

PDB Description: crystal structure of the catalytic domain of mmp-12 in complex with a selective sugar-conjugated triazole-linked carboxylate chelator water-soluble inhibitor (dc32).
PDB Compounds: (D:) Macrophage metalloelastase

SCOPe Domain Sequences for d5i43d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i43d_ d.92.1.11 (D:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhqighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d5i43d_:

Click to download the PDB-style file with coordinates for d5i43d_.
(The format of our PDB-style files is described here.)

Timeline for d5i43d_: