Lineage for d5b5vd_ (5b5v D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708838Superfamily a.29.7: Mob1/phocein [101152] (2 families) (S)
    common fold is elaborated with additional short helices; contains a zinc-binding site
    automatically mapped to Pfam PF03637
  5. 2708839Family a.29.7.1: Mob1/phocein [101153] (2 proteins)
  6. 2708845Protein automated matches [319235] (2 species)
    not a true protein
  7. 2708858Species Mouse (Mus musculus) [TaxId:10090] [319236] (2 PDB entries)
  8. 2708862Domain d5b5vd_: 5b5v D: [319292]
    automated match to d1pi1a_
    complexed with cl, zn

Details for d5b5vd_

PDB Entry: 5b5v (more details), 2.19 Å

PDB Description: structure of full-length mob1b
PDB Compounds: (D:) MOB kinase activator 1B

SCOPe Domain Sequences for d5b5vd_:

Sequence, based on SEQRES records: (download)

>d5b5vd_ a.29.7.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gshqyellkhaeatlgsgnlrmavmlpegedlnewvavntvdffnqinmlygtitdfcte
escpvmsagpkyeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfp
knfmsvaktilkrlfrvyahiyhqhfdpviqlqeeahlntsfkhfiffvqefnlidrrel
aplqeliek

Sequence, based on observed residues (ATOM records): (download)

>d5b5vd_ a.29.7.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gshqyellkhaeatlgsgnlrmavmlpegedlnewvavntvdffnqinmlygtitdfcte
escpvmsagpkyeyhwacsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvakti
lkrlfrvyahiyhqhfdpviqlqeeahlntsfkhfiffvqefnlidrrelaplqeliek

SCOPe Domain Coordinates for d5b5vd_:

Click to download the PDB-style file with coordinates for d5b5vd_.
(The format of our PDB-style files is described here.)

Timeline for d5b5vd_: