Class b: All beta proteins [48724] (177 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.0: automated matches [191368] (1 protein) not a true family |
Protein automated matches [190445] (6 species) not a true protein |
Species Potato (Solanum tuberosum) [TaxId:4113] [226410] (9 PDB entries) |
Domain d5fzza_: 5fzz A: [319291] automated match to d5dzua_ |
PDB Entry: 5fzz (more details), 2.55 Å
SCOPe Domain Sequences for d5fzza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fzza_ b.42.4.0 (A:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]} plpkpvldtngkelnpnssyriisigrgalggdvylgkspnsdapcpdgvfrynsdvgps gtpvrfiplstnifedqllniqfniptvklcvsytiwkvgnlnayfrtmlletggtigqa dnsyfkivksskigynllscpftsiiclrcpedqfcakvgvviqngkrrlalvnenpldv lfqev
Timeline for d5fzza_: