Lineage for d2tmkb_ (2tmk B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109670Protein Thymidylate kinase [52563] (4 species)
  7. 2109671Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52564] (3 PDB entries)
  8. 2109683Domain d2tmkb_: 2tmk B: [31929]
    complexed with atm, so4

Details for d2tmkb_

PDB Entry: 2tmk (more details), 2.4 Å

PDB Description: yeast thymidylate kinase complexed with 3'-azido-3'-deoxythymidine monophosphate (azt-mp)
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d2tmkb_:

Sequence, based on SEQRES records: (download)

>d2tmkb_ c.37.1.1 (B:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
grgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqlsd
qaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdvg
llkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesitiv
dvtnkgiqevealiwqivepvlsthidhdkfsff

Sequence, based on observed residues (ATOM records): (download)

>d2tmkb_ c.37.1.1 (B:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
grgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqlsd
qaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdvg
llkpdltlflstqfgderyetvkfqekvkqtfmklldkeirkgdesitivdvtnkgiqev
ealiwqivepvlsthidhdkfsff

SCOPe Domain Coordinates for d2tmkb_:

Click to download the PDB-style file with coordinates for d2tmkb_.
(The format of our PDB-style files is described here.)

Timeline for d2tmkb_: