Lineage for d5a6db1 (5a6d B:2-122)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977521Species Thermococcus gammatolerans [TaxId:593117] [319283] (1 PDB entry)
  8. 2977524Domain d5a6db1: 5a6d B:2-122 [319284]
    automated match to d3lx1a1

Details for d5a6db1

PDB Entry: 5a6d (more details), 2.8 Å

PDB Description: proliferating cell nuclear antigen, pcna, from thermococcus gammatolerans
PDB Compounds: (B:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d5a6db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a6db1 d.131.1.0 (B:2-122) automated matches {Thermococcus gammatolerans [TaxId: 593117]}
pfeivfdgakefadliatasnlideaafkiteegvsmramdpsrvvlidlnlpesifsky
eveepetiginmdhfkkilkrgkskdtlilrkgdenfleitfegtakrtfrlplidveel
e

SCOPe Domain Coordinates for d5a6db1:

Click to download the PDB-style file with coordinates for d5a6db1.
(The format of our PDB-style files is described here.)

Timeline for d5a6db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5a6db2