SCOPe 2.08: Domain d5a62a_: 5a62 A:

Lineage for d5a62a_ (5a62 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Candidatus nitrososphaera [TaxId:497727] [319280] (1 PDB entry)

8. Domain d5a62a_: 5a62 A: [319281]
   automated match to d1hkha_
   complexed with act

Details for d5a62a_

PDB Entry: 5a62, 1.5 Å

PDB Description: hydrolytic potential of the ammonia-oxidizing thaumarchaeon nitrososphaera gargenis - crystal structure and activity profiles of carboxylesterases linked to their metabolic function

PDB Compounds: (A:) putative alpha/beta hydrolase fold protein

SCOPe Domain Sequences for d5a62a_:

Sequence; same for both SEQRES and ATOM records:

>d5a62a_ c.69.1.0 (A:) automated matches {Candidatus nitrososphaera [TaxId: 497727]}
pflsspsnsvstyyedhgdarsyplvlihpiggniliwdyeiqlllksgfrviayelrgh
hrtnmgktgaytmqdliddlrrllehlnigkctiighsiggiissmyaaqhpgkvdaiim
ingspkkfqekdlekhfrtrevaitqgmkalaehklvsldeardlfadkrhadffrevft
ktsvegfvaatvalytipgnvvqglrasgckvfaivgsdddvfmrliketkeeipemelr
vlqgsdhwvviekpkemydilmgflaivtkdv

Timeline for d5a62a_:

• d5a62a_ first appeared in SCOPe 2.06
  
• d5a62a_ appears in SCOPe 2.07