SCOPe 2.08: Domain d5ekaa_: 5eka A:

Lineage for d5ekaa_ (5eka A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.0: automated matches [191573] (1 protein)
   not a true family

6. Protein automated matches [191007] (11 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [319276] (1 PDB entry)

8. Domain d5ekaa_: 5eka A: [319277]
   automated match to d1owfa_
   complexed with gol

Details for d5ekaa_

PDB Entry: 5eka, 1.69 Å

PDB Description: hu dna-binding protein from thermus thermophilus

PDB Compounds: (A:) DNA-binding protein HU

SCOPe Domain Sequences for d5ekaa_:

Sequence, based on SEQRES records:

>d5ekaa_ a.55.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
aakktvtkadlvdqvaqatglkkkdvkamvdallakveealangskvqltgfgtfevrkr
kartgvkpgtkekikipatqypafkpgkalkdkvkk

Sequence, based on observed residues (ATOM records):

>d5ekaa_ a.55.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
aakktvtkadlvdqvaqatglkkkdvkamvdallakveealangskvqltgfgtfevrkr
kartipatqypafkpgkalkdkvkk

Timeline for d5ekaa_:

• d5ekaa_ first appeared in SCOPe 2.06
  
• d5ekaa_ appears in SCOPe 2.07