SCOPe 2.08: Domain d5g4sa1: 5g4s A:624-738

Lineage for d5g4sa1 (5g4s A:624-738)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d5g4sa1: 5g4s A:624-738 [319275]
   Other proteins in same PDB: d5g4sa2
   automated match to d5fg5a_
   complexed with 8vi, edo

Details for d5g4sa1

PDB Entry: 5g4s, 1.6 Å

PDB Description: bromodomain of human brpf1 with n-1,3-dimethyl-6-2r-2- methylpiperazin-1-yl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl-n- ethyl-2-methoxybenzamide

PDB Compounds: (A:) Peregrin

SCOPe Domain Sequences for d5g4sa1:

Sequence; same for both SEQRES and ATOM records:

>d5g4sa1 a.29.2.0 (A:624-738) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iamemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnle
ayrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaek

Timeline for d5g4sa1:

• d5g4sa1 first appeared in SCOPe 2.06
  
• d5g4sa1 appears in SCOPe 2.07