SCOPe 2.06: Domain d5ce3a1: 5ce3 A:5-146

Lineage for d5ce3a1 (5ce3 A:5-146)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (52 species)
   not a true protein

7. Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [269613] (2 PDB entries)

8. Domain d5ce3a1: 5ce3 A:5-146 [319262]
   Other proteins in same PDB: d5ce3a2, d5ce3c2
   automated match to d2btfa1
   complexed with adp, atp, ca, mg

Details for d5ce3a1

PDB Entry: 5ce3, 2.93 Å

PDB Description: the yersinia yopo - actin complex with mgadp

PDB Compounds: (A:) actin

SCOPe Domain Sequences for d5ce3a1:

Sequence, based on SEQRES records:

>d5ce3a1 c.55.1.0 (A:5-146) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
vaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimf
etfnspamhvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d5ce3a1 c.55.1.0 (A:5-146) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
vaalvvdngsgmckagfagddapravfpsivgrprsyvgdeaqskrgiltlkypiehgii
tnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfnspamhvai
qavlslyasg

Timeline for d5ce3a1:

• d5ce3a1 is new in SCOPe 2.06-stable
  
• d5ce3a1 appears in SCOPe 2.07
  
• d5ce3a1 appears in the current release, SCOPe 2.08