Lineage for d3tmkg_ (3tmk G:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179164Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
  6. 179299Protein Thymidylate kinase [52563] (4 species)
  7. 179300Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52564] (3 PDB entries)
  8. 179309Domain d3tmkg_: 3tmk G: [31926]

Details for d3tmkg_

PDB Entry: 3tmk (more details), 2 Å

PDB Description: crystal structure of yeast thymidylate kinase complexed with the bisubstrate inhibitor tp5a at 2.0 a resolution: implications for catalysis and azt activation

SCOP Domain Sequences for d3tmkg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tmkg_ c.37.1.1 (G:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae)}
mgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqls
dqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdv
gllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesiti
vdvtnkgiqevealiwqivepvlsthidhdkfsff

SCOP Domain Coordinates for d3tmkg_:

Click to download the PDB-style file with coordinates for d3tmkg_.
(The format of our PDB-style files is described here.)

Timeline for d3tmkg_: