Lineage for d5bwfb1 (5bwf B:1-453)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2419554Species Trichoderma harzianum [TaxId:5544] [319250] (3 PDB entries)
  8. 2419559Domain d5bwfb1: 5bwf B:1-453 [319251]
    Other proteins in same PDB: d5bwfa2, d5bwfa3, d5bwfb2, d5bwfb3
    automated match to d3gnra_
    complexed with gol, so4

Details for d5bwfb1

PDB Entry: 5bwf (more details), 2.6 Å

PDB Description: crystal structure of the beta-glucosidase from trichoderma harzianum
PDB Compounds: (B:) Beta-1,4-glucosidase

SCOPe Domain Sequences for d5bwfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bwfb1 c.1.8.0 (B:1-453) automated matches {Trichoderma harzianum [TaxId: 5544]}
mlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgkiadgtsgvtacdsynrtaed
iallkslgaksyrfsiswsriipkggrddpvnqlgidhyaqfvddlleagitpfitlfhw
dlpeelhqryggllnrtefpldfenyarvmfkalpkvrnwitfneplcsaipgygsgtfa
pgrqsttepwivghnllvahgravkvyrdefkdlndgqigivlngdftypwdssdpldre
aaerrlefftawyadpiylgdypasmrkqlgdrlpeftpeekafvlgsndfygmnhytsn
yirhrtspataddtvgnvdvlfynkegqcigpetesswlrpcpagfrdflvwiskrynyp
kiyvtengtslkgendlpkekileddfrvnyyneyiramftaatldgvnvkgyfawslmd
nfewadgyvtrfgvtyvdyengqqrfpkksaks

SCOPe Domain Coordinates for d5bwfb1:

Click to download the PDB-style file with coordinates for d5bwfb1.
(The format of our PDB-style files is described here.)

Timeline for d5bwfb1: