Lineage for d3tmkf_ (3tmk F:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1593544Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1593978Protein Thymidylate kinase [52563] (4 species)
  7. 1593979Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52564] (3 PDB entries)
  8. 1593987Domain d3tmkf_: 3tmk F: [31925]
    complexed with t5a

Details for d3tmkf_

PDB Entry: 3tmk (more details), 2 Å

PDB Description: crystal structure of yeast thymidylate kinase complexed with the bisubstrate inhibitor tp5a at 2.0 a resolution: implications for catalysis and azt activation
PDB Compounds: (F:) thymidylate kinase

SCOPe Domain Sequences for d3tmkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tmkf_ c.37.1.1 (F:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
ivdvtnkgiqevealiwqivepvlsthidhdkfsff

SCOPe Domain Coordinates for d3tmkf_:

Click to download the PDB-style file with coordinates for d3tmkf_.
(The format of our PDB-style files is described here.)

Timeline for d3tmkf_: