SCOP 1.59: Domain d3tmkf_: 3tmk F:

Lineage for d3tmkf_ (3tmk F:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families)

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins)

6. Protein Thymidylate kinase [52563] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52564] (3 PDB entries)

8. Domain d3tmkf_: 3tmk F: [31925]

Details for d3tmkf_

PDB Entry: 3tmk, 2 Å

PDB Description: crystal structure of yeast thymidylate kinase complexed with the bisubstrate inhibitor tp5a at 2.0 a resolution: implications for catalysis and azt activation

SCOP Domain Sequences for d3tmkf_:

Sequence; same for both SEQRES and ATOM records:

>d3tmkf_ c.37.1.1 (F:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae)}
mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
ivdvtnkgiqevealiwqivepvlsthidhdkfsff

Timeline for d3tmkf_:

• d3tmkf_ first appeared (with stable ids) in SCOP 1.55
  
• d3tmkf_ appears in SCOP 1.57
  
• d3tmkf_ appears in SCOP 1.61
  
• d3tmkf_ appears in the current release, SCOPe 2.08