Lineage for d3tmke_ (3tmk E:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829352Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 829678Protein Thymidylate kinase [52563] (4 species)
  7. 829679Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52564] (3 PDB entries)
  8. 829686Domain d3tmke_: 3tmk E: [31924]

Details for d3tmke_

PDB Entry: 3tmk (more details), 2 Å

PDB Description: crystal structure of yeast thymidylate kinase complexed with the bisubstrate inhibitor tp5a at 2.0 a resolution: implications for catalysis and azt activation
PDB Compounds: (E:) thymidylate kinase

SCOP Domain Sequences for d3tmke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tmke_ c.37.1.1 (E:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqls
dqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdv
gllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesiti
vdvtnkgiqevealiwqivepvlsthidhdkfsff

SCOP Domain Coordinates for d3tmke_:

Click to download the PDB-style file with coordinates for d3tmke_.
(The format of our PDB-style files is described here.)

Timeline for d3tmke_: