Lineage for d3tmke_ (3tmk E:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 22944Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (8 proteins)
  6. 23033Protein Thymidylate kinase [52563] (2 species)
  7. 23034Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52564] (3 PDB entries)
  8. 23041Domain d3tmke_: 3tmk E: [31924]

Details for d3tmke_

PDB Entry: 3tmk (more details), 2 Å

PDB Description: crystal structure of yeast thymidylate kinase complexed with the bisubstrate inhibitor tp5a at 2.0 a resolution: implications for catalysis and azt activation

SCOP Domain Sequences for d3tmke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tmke_ c.37.1.1 (E:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae)}
mgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqls
dqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdv
gllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesiti
vdvtnkgiqevealiwqivepvlsthidhdkfsff

SCOP Domain Coordinates for d3tmke_:

Click to download the PDB-style file with coordinates for d3tmke_.
(The format of our PDB-style files is described here.)

Timeline for d3tmke_: