![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.7: Mob1/phocein [101152] (1 family) ![]() common fold is elaborated with additional short helices; contains a zinc-binding site automatically mapped to Pfam PF03637 |
![]() | Family a.29.7.1: Mob1/phocein [101153] (2 proteins) |
![]() | Protein automated matches [319235] (2 species) not a true protein |
![]() | Species Mus musculus [TaxId:10090] [319236] (2 PDB entries) |
![]() | Domain d5b5va_: 5b5v A: [319238] automated match to d1pi1a_ complexed with cl, zn |
PDB Entry: 5b5v (more details), 2.19 Å
SCOPe Domain Sequences for d5b5va_:
Sequence, based on SEQRES records: (download)
>d5b5va_ a.29.7.1 (A:) automated matches {Mus musculus [TaxId: 10090]} pegshqyellkhaeatlgsgnlrmavmlpegedlnewvavntvdffnqinmlygtitdfc teescpvmsagpkyeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvp fpknfmsvaktilkrlfrvyahiyhqhfdpviqlqeeahlntsfkhfiffvqefnlidrr elaplqeliekl
>d5b5va_ a.29.7.1 (A:) automated matches {Mus musculus [TaxId: 10090]} pegshqyellkhaeatlgsgnlrmavmlpegedlnewvavntvdffnqinmlygtitdfc teescpvmsagpkyeyhwadgpikcsapkyidylmtwvqdqlddetlfpskigvpfpknf msvaktilkrlfrvyahiyhqhfdpviqlqeeahlntsfkhfiffvqefnlidrrelapl qeliekl
Timeline for d5b5va_: