Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (14 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318877] (4 PDB entries) |
Domain d5a4ub2: 5a4u B:87-212 [319220] Other proteins in same PDB: d5a4ua1, d5a4ub1, d5a4uc1, d5a4ud1, d5a4ue1, d5a4uf1 automated match to d1gnwa1 complexed with act, i3a |
PDB Entry: 5a4u (more details), 2 Å
SCOPe Domain Sequences for d5a4ub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a4ub2 a.45.1.1 (B:87-212) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp asekvq
Timeline for d5a4ub2: