![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein automated matches [226848] (14 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318877] (4 PDB entries) |
![]() | Domain d5a4vd2: 5a4v D:87-212 [319213] Other proteins in same PDB: d5a4va1, d5a4vb1, d5a4vc1, d5a4vd1, d5a4ve1, d5a4vf1 automated match to d1gnwa1 complexed with act, que |
PDB Entry: 5a4v (more details), 2.38 Å
SCOPe Domain Sequences for d5a4vd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a4vd2 a.45.1.1 (D:87-212) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp asekvq
Timeline for d5a4vd2: