Lineage for d3tmkb_ (3tmk B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121669Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins)
  6. 121798Protein Thymidylate kinase [52563] (4 species)
  7. 121799Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52564] (3 PDB entries)
  8. 121803Domain d3tmkb_: 3tmk B: [31921]

Details for d3tmkb_

PDB Entry: 3tmk (more details), 2 Å

PDB Description: crystal structure of yeast thymidylate kinase complexed with the bisubstrate inhibitor tp5a at 2.0 a resolution: implications for catalysis and azt activation

SCOP Domain Sequences for d3tmkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tmkb_ c.37.1.1 (B:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae)}
mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
ivdvtnkgiqevealiwqivepvlsthidhdkfsff

SCOP Domain Coordinates for d3tmkb_:

Click to download the PDB-style file with coordinates for d3tmkb_.
(The format of our PDB-style files is described here.)

Timeline for d3tmkb_: