Lineage for d3tmka_ (3tmk A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69450Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (8 proteins)
  6. 69548Protein Thymidylate kinase [52563] (3 species)
  7. 69549Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52564] (3 PDB entries)
  8. 69552Domain d3tmka_: 3tmk A: [31920]

Details for d3tmka_

PDB Entry: 3tmk (more details), 2 Å

PDB Description: crystal structure of yeast thymidylate kinase complexed with the bisubstrate inhibitor tp5a at 2.0 a resolution: implications for catalysis and azt activation

SCOP Domain Sequences for d3tmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae)}
mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
ivdvtnkgiqevealiwqivepvlsthidhdkfsff

SCOP Domain Coordinates for d3tmka_:

Click to download the PDB-style file with coordinates for d3tmka_.
(The format of our PDB-style files is described here.)

Timeline for d3tmka_: