Lineage for d4zfmc_ (4zfm C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2419125Species Geobacillus stearothermophilus [TaxId:1422] [319127] (16 PDB entries)
  8. 2419148Domain d4zfmc_: 4zfm C: [319193]
    automated match to d1pbga_
    complexed with 0wk, bg6, bgc, gol, imd

Details for d4zfmc_

PDB Entry: 4zfm (more details), 1.4 Å

PDB Description: structure of gan1d-e170q in complex with cellobiose-6-phosphate
PDB Compounds: (C:) Putative 6-phospho-beta-galactobiosidase

SCOPe Domain Sequences for d4zfmc_:

Sequence, based on SEQRES records: (download)

>d4zfmc_ c.1.8.0 (C:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqnifisfgyrlglh
ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr
rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca
wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael

Sequence, based on observed residues (ATOM records): (download)

>d4zfmc_ c.1.8.0 (C:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqnifisfgyrlglh
ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
tvehnppdgvgtssgipglfktvrnphvdttnwdwaidpvglriglrrianryqlpilit
englgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgycawsftdllswlngy
qkrygfvyvnrddesekdlrrikkksfywyqrvietngael

SCOPe Domain Coordinates for d4zfmc_:

Click to download the PDB-style file with coordinates for d4zfmc_.
(The format of our PDB-style files is described here.)

Timeline for d4zfmc_: