Lineage for d1tmkb_ (1tmk B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179164Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
  6. 179299Protein Thymidylate kinase [52563] (4 species)
  7. 179300Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52564] (3 PDB entries)
  8. 179302Domain d1tmkb_: 1tmk B: [31919]

Details for d1tmkb_

PDB Entry: 1tmk (more details), 2.1 Å

PDB Description: yeast thymidylate kinase complexed with thymidine monophosphate (dtmp)

SCOP Domain Sequences for d1tmkb_:

Sequence, based on SEQRES records: (download)

>d1tmkb_ c.37.1.1 (B:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae)}
grgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqlsd
qaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdvg
llkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesitiv
dvtnkgiqevealiwqivepvlsthidhdkfsff

Sequence, based on observed residues (ATOM records): (download)

>d1tmkb_ c.37.1.1 (B:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae)}
grgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqlsd
qaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdvg
llkpdltlflstqfgderyetvkfqekvkqtfmklldkeirkgdesitivdvtnkgiqev
ealiwqivepvlsthidhdkfsff

SCOP Domain Coordinates for d1tmkb_:

Click to download the PDB-style file with coordinates for d1tmkb_.
(The format of our PDB-style files is described here.)

Timeline for d1tmkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tmka_