Lineage for d4zh5a_ (4zh5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722309Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2722310Protein automated matches [190108] (23 species)
    not a true protein
  7. 2722351Species Perinereis brevicirris [TaxId:6356] [319158] (2 PDB entries)
  8. 2722352Domain d4zh5a_: 4zh5 A: [319185]
    automated match to d1ia6a_
    complexed with ca, cl, na

Details for d4zh5a_

PDB Entry: 4zh5 (more details), 1.35 Å

PDB Description: crystal structure of endoglucanase from perinereis brevicirris with cellobiose
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d4zh5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zh5a_ a.102.1.0 (A:) automated matches {Perinereis brevicirris [TaxId: 6356]}
qynyrevlqksilfyaaqrsgqlpgnnpidwrddsalddqgnggedltggwydagdhvkf
glpmawtattliwgmidlangyggdrndamqsvrwaldyfmkchvsdnelygqvgdghad
haywgrpeemtmdrpawsltpsapgsdlagetaaalaagsilfsdsdasyanqlldhart
iydfaynnrgiysesipnaadfyrssayedelcwgalwlyratgeqdymdkaneflpqgr
pwafswdskeagslvlltsfgnsnaraqledflqswfpggdihytplglawrdtwgslry
sansafiallaaeegvltsqartfaraqldymlgstgrsfvvgfgtnpplrphhraascp
dmpascgwdqasdpapnpqvldgalvggpddqdnynddrqdyisnevacdynagfqgala
gilql

SCOPe Domain Coordinates for d4zh5a_:

Click to download the PDB-style file with coordinates for d4zh5a_.
(The format of our PDB-style files is described here.)

Timeline for d4zh5a_: