Lineage for d4zk6a_ (4zk6 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2170581Fold c.145: NadA-like [142753] (1 superfamily)
    duplication; consists of three similar domains related by pseudo threefold symmetry; 3 layers, a/b/a; parallel beta sheet, order: 2134
  4. 2170582Superfamily c.145.1: NadA-like [142754] (2 families) (S)
    automatically mapped to Pfam PF02445
  5. 2170583Family c.145.1.1: NadA-like [142755] (1 protein)
    Pfam PF02445
  6. 2170584Protein Quinolinate synthetase A, NadA [142756] (2 species)
  7. 2170587Species Pyrococcus horikoshii [TaxId:70601] [319156] (8 PDB entries)
  8. 2170595Domain d4zk6a_: 4zk6 A: [319181]
    automated match to d1wzua1
    complexed with act, cl, na, ntm, sf4

Details for d4zk6a_

PDB Entry: 4zk6 (more details), 1.9 Å

PDB Description: crystallographic capture of quinolinate synthase (nada) from pyrococcus horikoshii in its substrates and product-bound states
PDB Compounds: (A:) Quinolinate synthase A

SCOPe Domain Sequences for d4zk6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zk6a_ c.145.1.1 (A:) Quinolinate synthetase A, NadA {Pyrococcus horikoshii [TaxId: 70601]}
mdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdf
maetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakaya
dvtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftldd
verakklhpnaklmihpecipevqekadiiastggmikracewdewvvfteremvyrlrk
lypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlems

SCOPe Domain Coordinates for d4zk6a_:

Click to download the PDB-style file with coordinates for d4zk6a_.
(The format of our PDB-style files is described here.)

Timeline for d4zk6a_: