Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.2: Monomeric isocitrate dehydrogenase [82526] (2 proteins) the active site is contained within one subunit between the canonical ICDH fold and a large insert domain that itself is a probable rudiment form of ICDH fold resulted from duplication, domain swapping and deletion automatically mapped to Pfam PF03971 |
Protein automated matches [190493] (6 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:1772] [319123] (1 PDB entry) |
Domain d4zdaf_: 4zda F: [319180] automated match to d2b0ta_ complexed with ict, mn |
PDB Entry: 4zda (more details), 2.8 Å
SCOPe Domain Sequences for d4zdaf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zdaf_ c.77.1.2 (F:) automated matches {Mycobacterium smegmatis [TaxId: 1772]} ptiiytltdeapllatyaflpvvrkfaeaagidvktsdisvaarilaefgdhlteeqrvp dnlgelgaltqdpsaniiklpnisasvpqllaaikelqgkgynvpdypanpktddekkik dryakilgsavnpvlregnsdrrapkavkeyarkhphsmgewsqasrthvatmktgdfyh geksmtldrdrrvkmvlktksgeeivlkpevkldagdiidsmymskkaliafyeeqieda yktgvmfslhvkatmmkvshpivfghavkvfykdafakheklfdelgvnvnnglsdlydk iealpasqreeiiedlhkchehrpelamvdsakgisnfhspsdvivdasmpamirlggkm ygadgrtkdtkavnpestfsrmyqeminfckthgqfdpttmgtvpnvglmaqkaeeygsh dktfeipedgvadivdidtgevlltqnveegdiwrmpivkdapirdwvklavtrarlsgm pvvfwldterphevelrkkvkeylkdhdteglkiqimpqvwamrytlervvrgkdtiaat gnilrdyltdlfpilelgtsakmlsivplmaggglyetgaggsapkhvhqlveenhlrwd slgeflalgasledmgnktgnekakvlakaldtatgklleenkspsrrtgeldnrgsqfy lslfwaqalaeqtedaelaerfkplakalaeqeeaivselnsvqgktvdiggyyypdpek tsevmrpsktfnttl
Timeline for d4zdaf_: