![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) ![]() |
![]() | Family a.102.1.0: automated matches [191318] (1 protein) not a true family |
![]() | Protein automated matches [190108] (21 species) not a true protein |
![]() | Species Perinereis brevicirris [TaxId:6356] [319158] (2 PDB entries) |
![]() | Domain d4zh5b_: 4zh5 B: [319179] automated match to d1ia6a_ complexed with bgc, ca, cl, na |
PDB Entry: 4zh5 (more details), 1.35 Å
SCOPe Domain Sequences for d4zh5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zh5b_ a.102.1.0 (B:) automated matches {Perinereis brevicirris [TaxId: 6356]} qynyrevlqksilfyaaqrsgqlpgnnpidwrddsalddqgnggedltggwydagdhvkf glpmawtattliwgmidlangyggdrndamqsvrwaldyfmkchvsdnelygqvgdghad haywgrpeemtmdrpawsltpsapgsdlagetaaalaagsilfsdsdasyanqlldhart iydfaynnrgiysesipnaadfyrssayedelcwgalwlyratgeqdymdkaneflpqgr pwafswdskeagslvlltsfgnsnaraqledflqswfpggdihytplglawrdtwgslry sansafiallaaeegvltsqartfaraqldymlgstgrsfvvgfgtnpplrphhraascp dmpascgwdqasdpapnpqvldgalvggpddqdnynddrqdyisnevacdynagfqgala gilql
Timeline for d4zh5b_: