Lineage for d5a4uf2 (5a4u F:87-212)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2321894Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 2322548Protein automated matches [226848] (11 species)
    not a true protein
  7. 2322706Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318877] (4 PDB entries)
  8. 2322712Domain d5a4uf2: 5a4u F:87-212 [319172]
    Other proteins in same PDB: d5a4ua1, d5a4ub1, d5a4uc1, d5a4ud1, d5a4ue1, d5a4uf1
    automated match to d1gnwa1
    complexed with act, i3a

Details for d5a4uf2

PDB Entry: 5a4u (more details), 2 Å

PDB Description: atgstf2 from arabidopsis thaliana in complex with indole-3-aldehyde
PDB Compounds: (F:) glutathione s-transferase f2

SCOPe Domain Sequences for d5a4uf2:

Sequence, based on SEQRES records: (download)

>d5a4uf2 a.45.1.1 (F:87-212) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak
vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp
asekvq

Sequence, based on observed residues (ATOM records): (download)

>d5a4uf2 a.45.1.1 (F:87-212) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglavvaeeeaklakvldv
yearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrpasek
vq

SCOPe Domain Coordinates for d5a4uf2:

Click to download the PDB-style file with coordinates for d5a4uf2.
(The format of our PDB-style files is described here.)

Timeline for d5a4uf2: