| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein automated matches [227019] (3 species) not a true protein |
| Species Arabidopsis thaliana [TaxId:3702] [318873] (4 PDB entries) |
| Domain d5a4uf1: 5a4u F:3-86 [319171] Other proteins in same PDB: d5a4ua2, d5a4ub2, d5a4uc2, d5a4ud2, d5a4ue2, d5a4uf2 automated match to d1gnwa2 complexed with act, i3a |
PDB Entry: 5a4u (more details), 2 Å
SCOPe Domain Sequences for d5a4uf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a4uf1 c.47.1.5 (F:3-86) automated matches {Arabidopsis thaliana [TaxId: 3702]}
gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
lklfesraitqyiahryenqgtnl
Timeline for d5a4uf1: